Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine receptor
LigandBDBM21398
Substrate/Competitorn/a
Ki 9.8±n/a nM
CommentsPDSP_918
Citation Sokoloff, PGiros, BMartres, MPBouthenet, MLSchwartz, JC Molecular cloning and characterization of a novel dopamine receptor (D3) as a target for neuroleptics. Nature347:146-51 (1990) [PubMed]  Article
More Info.:Get all data from this article
 
Dopamine receptor
Name:Dopamine receptor D2 and D3
Synonyms:D(3) dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor
Type:Protein
Mol. Mass.:49540.58
Organism:Rattus norvegicus (Rat)
Description:P19020
Residue:446
Sequence:
MAPLSQISTHLNSTCGAENSTGVNRARPHAYYALSYCALILAIIFGNGLVCAAVLRERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPSI
CSISNPDFVIYSSVVSFYVPFGVTVLVYARIYIVLRQRQRKRILTRQNSQCISIRPGFPQ
QSSCLRLHPIRQFSIRARFLSDATGQMEHIEDKQYPQKCQDPLLSHLQPPSPGQTHGGLK
RYYSICQDTALRHPSLEGGAGMSPVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLRLGP
LQPRGVPLREKKATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACHVSPELYRATTWLGYV
NSALNPVIYTTFNVEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21398
NameBDBM21398
Synonyms:4-[4-(4-Chloro-phenyl)-4-hydroxy-piperidin-1-yl]-1-(4-fluoro-phenyl)-butan-1-one;propionate(HCl) | 4-[4-(4-chlorophenyl)-4-hydroxypiperidin-1-yl]-1-(4-fluorophenyl)butan-1-one | CHEMBL54 | CHEMBL545608 | Haloperidol | Haloperidol, 1
TypeSmall organic molecule
Emp. Form.C21H23ClFNO2
Mol. Mass.375.864
SMILESOC1(CCN(CCCC(=O)c2ccc(F)cc2)CC1)c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a