Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D2 receptor/Serotonin 2 (5-HT2) receptor
LigandBDBM81195
Substrate/Competitorn/a
Ki 24.91±n/a nM
CommentsPDSP_239
Citation Sánchez-Roa, PMGrigoriadis, DEWilson, AASharkey, JDannals, RFVillemagne, VLWong, DFWagner, HNKuhar, MJ [125]I-spectramide: a novel benzamide displaying potent and selective effects at the D2 dopamine receptor. Life Sci45:1821-9 (1989) [PubMed]
More Info.:Get all data from this article
 
Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
Name:Dopamine D2 receptor and Serotonin 2a receptor (D2 and 5HT2a)
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DOPAMINE D2/D4 | DRD2 | Dopamine D2 receptor | Dopamine2-like
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:50931.60
Organism:Rattus norvegicus (rat)
Description:Receptor binding assays were performed using rat striatal membranes.
Residue:444
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81195
NameBDBM81195
Synonyms:(+/-)-2-Amino-6,7-dihydroxy-1,2,3,4-tetrahydronaphthalene hydrobromide | 2-aminotetralin-6,7-diol;hydrobromide | 6-Amino-5,6,7,8-tetrahydro-naphthalene-2,3-diol | 6-amino-5,6,7,8-tetrahydronaphthalene-2,3-diol;hydrobromide | 6-azanyl-5,6,7,8-tetrahydronaphthalene-2,3-diol;hydrobromide | ADTN | ADTN, (+) | CA inhibitor, 3 | CHEMBL26736 | MLS002172466 | SMR001254097 | cid_11957526 | cid_3153
TypeSmall organic molecule
Emp. Form.C10H13NO2
Mol. Mass.179.2157
SMILESNC1CCc2cc(O)c(O)cc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a