Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM39341
Substrate/Competitorn/a
Ki 906±n/a nM
CommentsPDSP_1503
Citation Buckley, NJBonner, TIBuckley, CMBrann, MR Antagonist binding properties of five cloned muscarinic receptors expressed in CHO-K1 cells. Mol Pharmacol35:469-76 (1989) [PubMed]
More Info.:Get all data from this article
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic acetylcholine receptor M2 and M5
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM39341
NameBDBM39341
Synonyms:11-[(4-methylpiperazin-1-yl)acetyl]-5,11-dihydro-6H-pyrido[2,3-b][1,4]benzodiazepin-6-one | 11-[2-(4-methyl-1-piperazinyl)-1-oxoethyl]-5H-pyrido[2,3-b][1,4]benzodiazepin-6-one;hydrochloride | 11-[2-(4-methylpiperazin-1-yl)acetyl]-5H-pyrido[2,3-b][1,4]benzodiazepin-6-one;hydrochloride | 11-[2-(4-methylpiperazin-1-yl)ethanoyl]-5H-pyrido[2,3-b][1,4]benzodiazepin-6-one;hydrochloride | 11-[2-(4-methylpiperazino)acetyl]-5H-pyrido[2,3-b][1,4]benzodiazepin-6-one;hydrochloride | CHEMBL9967 | MLS000069702 | PIRENZEPINE | PIRENZEPINE DIHYDROCHLORIDE | SMR000058502 | cid_185248
TypeSmall organic molecule
Emp. Form.C19H21N5O2
Mol. Mass.351.4023
SMILESCN1CCN(CC(=O)N2c3ccccc3C(=O)Nc3cccnc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a