Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine Receptors A2a (A2a)
LigandBDBM35804
Substrate/Competitorn/a
Ki 21.9±n/a nM
CommentsPDSP_2625
Citation Hutchison, AJWebb, RLOei, HHGhai, GRZimmerman, MBWilliams, M CGS 21680C, an A2 selective adenosine receptor agonist with preferential hypotensive activity. J Pharmacol Exp Ther251:47-55 (1989) [PubMed]
More Info.:Get all data from this article
 
Adenosine Receptors A2a (A2a)
Name:Adenosine receptor A2a and A3
Synonyms:ADENOSINE A2a | Adenosine A2a receptor (A2a) | Adenosine receptors A2a | Rat striatal adenosine A2a receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:45015.65
Organism:Rattus norvegicus (rat)
Description:Rat A2A receptors expressed in CHO cells.
Residue:410
Sequence:
MGSSVYITVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFA
ITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGVRAKG
IIAICWVLSFAIGLTPMLGWNNCSQKDGNSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAF
VLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALC
WLPLHIINCFTFFCSTCRHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRT
HVLRRQEPFQAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSATHSGRRPNGYTLGL
GGGGSAQGSPRDVELPTQERQEGQEHPGLRGHLVQARVGASSWSSEFAPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35804
NameBDBM35804
Synonyms:(CGS21680) 3-(4-{2-[6-Amino-9-(5-ethylcarbamoylmethyl-3,4-dihydroxy-tetrahydro-furan-2-yl)-9H-purin-2-ylamino]-ethyl}-phenyl)-propionic acid | 2-[4-(2-carboxyethyl)-phenethylamino]-5''''-N-ethylcarboxamidoadenosine | 2-[4-(2-carboxyethyl)phenethylamino]-5''''-N-ethylcarboxamidoadenosine | 2-p-(2-carboxyethyl)phenethylamino-5''''-N-ethylcarboxamidoadenosine | 3-(4-(2-(6-amino-9-((2R,3R,4S,5S)-5-(ethylcarbamoyl)-3,4-dihydroxy-tetrahydrofuran-2-yl)-9H-purin-2-ylamino)ethyl)phenyl)propanoic acid | 3-(4-(2-(6-amino-9-((2R,3R,4S,5S)-5-(ethylcarbamoyl)-3,4-dihydroxytetrahydrofuran-2-yl)-9H-purin-2-ylamino)ethyl)phenyl)propanoic acid | 3-(4-{2-[6-Amino-9-((2R,3R,4S,5S)-5-ethylcarbamoyl-3,4-dihydroxy-tetrahydro-furan-2-yl)-9H-purin-2-ylamino]-ethyl}-phenyl)-propionic acid | CGS 21680 | CGS-21680 | CHEMBL331372 | [3H]-CGS 21680
Typeradiolabeled ligand
Emp. Form.C23H29N7O6
Mol. Mass.499.5197
SMILESCCNC(=O)[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N)nc(NCCc3ccc(CCC(O)=O)cc3)nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a