Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin
LigandBDBM81791
Substrate/Competitorn/a
Ki 0.15±n/a nM
CommentsPDSP_2688
Citation Van Dijk, ARichards, JGTrzeciak, AGillessen, DMöhler, H Cholecystokinin receptors: biochemical demonstration and autoradiographical localization in rat brain and pancreas using [3H] cholecystokinin8 as radioligand. J Neurosci4:1021-33 (1984) [PubMed]
More Info.:Get all data from this article
 
Cholecystokinin
Name:Cholecystokinin
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:12844.29
Organism:RAT
Description:Cholecystokinin 0 RAT::P01355
Residue:115
Sequence:
MKCGVCLCVVMAVLAAGALAQPVVPVEAVDPMEQRAEEAPRRQLRAVLRPDSEPRARLGA
LLARYIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDFGRRSAEDYEYPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81791
NameBDBM81791
Synonyms:Dopamine + GPP(NH)p | GPP(NH)P(+) | GPP(NH)p(-) | Guanylyl imidodiphosphate
Typen/a
Emp. Form.C10H17N6O13P3
Mol. Mass.522.1957
SMILESNc1nc2n(cnc2c(=O)[nH]1)[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)NP(O)(O)=O)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a