Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCCKBR
LigandBDBM50185261
Substrate/Competitorn/a
Ki 66±n/a nM
CommentsPDSP_2197
Citation Ito, HSogabe, HNakarai, TSato, YTomoi, MKadowaki, MMatsuo, MTokoro, KYoshida, K Pharmacological profile of FK480, a novel cholecystokinin type-A receptor antagonist: comparison to loxiglumide. J Pharmacol Exp Ther268:571-5 (1994) [PubMed]
More Info.:Get all data from this article
 
CCKBR
Name:CCKBR
Synonyms:Cholecystokinin A
Type:Enzyme Catalytic Domain
Mol. Mass.:48683.10
Organism:GUINEA PIG
Description:Cholecystokinin A CCKBR GUINEA PIG::H0VZC5
Residue:450
Sequence:
MELLKLNRSLQGPGPGPGAPLCRPAGPLLNSSGAGNVSCETPRIRGAGTRVKSMAILFNV
TSLLSCWNKYRIIKVLGLSRRLRTVTKAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFG
TVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVILATWLLSG
LLMVPYPVYTAVQPVGPRVLQCVHRWPNARVRQTWSVLLLLLLFFVPGVVMAVAYGLISR
ELYLGLRFDGDADSESQSRVRGPGGLSGSAPGPAHQNGRCRPESGLSGEDSDGCYVQLPR
SRPALELSALAASTPAPGPGPRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRA
FDGPGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLDTCARCCPRPPRARP
RPLPEEDPPTPSIASLSRLSYTTISTLGPG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50185261
NameBDBM50185261
Synonyms:4-(3,4-dichlorobenzamido)-5-((3-methoxypropyl)(pentyl)amino)-5-oxopentanoic acid | CHEMBL206025 | LOXIGLUMIDE
TypeSmall organic molecule
Emp. Form.C21H30Cl2N2O5
Mol. Mass.461.379
SMILESCCCCCN(CCCOC)C(=O)C(CCC(O)=O)NC(=O)c1ccc(Cl)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a