Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSSTR3
LigandBDBM82257
Substrate/Competitorn/a
Ki 0.03±n/a nM
CommentsPDSP_3339
Citation Rossowski, WJGu, ZFAkarca, USJensen, RTCoy, DH Characterization of somatostatin receptor subtypes controlling rat gastric acid and pancreatic amylase release. Peptides15:1421-4 (1994) [PubMed]
More Info.:Get all data from this article
 
SSTR3
Name:Somatostatin receptor
Synonyms:SOMATOSTATIN SST3 | Somatostatin receptor type 3
Type:Enzyme Catalytic Domain
Mol. Mass.:47161.54
Organism:RAT
Description:SOMATOSTATIN SST3 SSTR3 RAT::P30936
Residue:428
Sequence:
MAAVTYPSSVPTTLDPGNASSAWPLDTSLGNASAGTSLAGLAVSGILISLVYLVVCVVGL
LGNSLVIYVVLRHTSSPSVTSVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLV
MAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARMVSAAVWVASAVVVLPVV
VFSGVPRGMSTCHMQWPEPAAAWRTAFIIYTAALGFFGPLLVICLCYLLIVVKVRSTTRR
VRAPSCQWVQAPACQRRRRSERRVTRMVVAVVALFVLCWMPFYLLNIVNVVCPLPEEPAF
FGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRILLRPSRRVRSQEPGSGPPEKTEEE
EDEEEEERREEEERRMQRGQEMNGRLSQIAQPGPSGQQQRPCTGTAKEQQLLPQEATAGD
KASTLSHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82257
NameBDBM82257
Synonyms:D-Phe-Phe-Tyr-D-Trp-Lys-Val-Phe-Thr-NH2 | DC-25-12
Typen/a
Emp. Form.C61H75N11O10
Mol. Mass.1122.3159
SMILESCC(C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)C(N)c1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H]([C@@H](C)O)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a