Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSSTR4
LigandBDBM82253
Substrate/Competitorn/a
Ki 0.002±n/a nM
CommentsPDSP_382
Citation Rossowski, WJGu, ZFAkarca, USJensen, RTCoy, DH Characterization of somatostatin receptor subtypes controlling rat gastric acid and pancreatic amylase release. Peptides15:1421-4 (1994) [PubMed]
More Info.:Get all data from this article
 
SSTR4
Name:Somatostatin receptor
Synonyms:SOMATOSTATIN SST4 | Somatostatin receptor type 4
Type:Enzyme Catalytic Domain
Mol. Mass.:42096.84
Organism:RAT
Description:SOMATOSTATIN SST4 SSTR4 RAT::P30937
Residue:384
Sequence:
MNTPATLPLGGEDTTWTPGINASWAPDEEEDAVRSDGTGTAGMVTIQCIYALVCLVGLVG
NALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASAAALRHWPFGAVLCRAVLS
VDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLPIAVF
ADTRPARGGEAVACNLHWPHPAWSAVFVIYTFLLGFLLPVLAIGLCYLLIVGKMRAVALR
AGWQQRRRSEKKITRLVLMVVTVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILSYANS
CANPILYGFLSDNFRRSFQRVLCLRCCLLETTGGAEEEPLDYYATALKSRGGPGCICPPL
PCQQEPMQAEPACKRVPFTKTTTF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82253
NameBDBM82253
Synonyms:BIM 23052 | CAS_133073-82-2
TypeSmall organic molecule
Emp. Form.C61H75N11O10
Mol. Mass.1122.3159
SMILESC[C@@H](O)[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](N)Cc1ccccc1)[C@@H](C)O)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a