Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPACAP
LigandBDBM82449
Substrate/Competitorn/a
Ki 6000±n/a nM
CommentsPDSP_2425
Citation Hou, XVandermeers, AGourlet, PVandermeers-Piret, MCRobberecht, P Structural requirements for the occupancy of rat brain PACAP receptors and adenylate cyclase activation. Neuropharmacology33:1189-95 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
PACAP
Name:PACAP
Synonyms:PACAP-27 | PACAP-38 | Pituitary adenylate cyclase-activating polypeptide
Type:Enzyme Catalytic Domain
Mol. Mass.:19565.66
Organism:RAT
Description:PACAP 0 RAT::P13589
Residue:175
Sequence:
MTMCSGARLALLVYGIIMHNSVSCSPAAGLSFPGIRPEEEAYDQDGNPLQDFYDWDPPGA
GSPASALRDAYALYYPADRRDVAHEILNEAYRKVLDQLSARKYLQSMVARGMGENLAAAA
VDDRAPLTKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82449
NameBDBM82449
Synonyms:PACAP(11-27)
TypeSmall organic molecule
Emp. Form.C92H158N28O21S
Mol. Mass.2024.479
SMILES[#6]-[#16]-[#6]-[#6]-[#6@H](-[#7]-[#6](=O)-[#6@H](-[#6]-[#6]-[#6](-[#7])=O)-[#7]-[#6](=O)-[#6@H](-[#6]-[#6]-[#6]-[#6]-[#7])-[#7]-[#6](=O)-[#6@H](-[#6]-[#6]-[#6]\[#7]=[#6](/[#7])-[#7])-[#7]-[#6](=O)-[#6@H](-[#6]-c1ccc(-[#8])cc1)-[#7]-[#6](=O)-[#6@H](-[#6]-[#6]-[#6]\[#7]=[#6](/[#7])-[#7])-[#7]-[#6](=O)-[#6@@H](-[#7])-[#6]-[#8])-[#6](=O)-[#7]-[#6@@H](-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6](-[#6])-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]-[#6]-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]-[#6]-[#7])-[#6](=O)-[#7]-[#6@@H](-[#6]-c1ccc(-[#8])cc1)-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6](-[#6])-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6](-[#6])-[#6])-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6](-[#6])-[#6])-[#6](-[#7])=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a