Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSSTR2
LigandBDBM82469
Substrate/Competitorn/a
Ki 0.01±n/a nM
CommentsPDSP_372
Citation Hoyer, DLübbert, HBruns, C Molecular pharmacology of somatostatin receptors. Naunyn Schmiedebergs Arch Pharmacol350:441-53 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
SSTR2
Name:Somatostatin receptor
Synonyms:SOMATOSTATIN SST2 | Somatostatin receptor | Somatostatin receptor 2 | Somatostatin receptor type 2
Type:Enzyme Catalytic Domain
Mol. Mass.:41234.26
Organism:MOUSE
Description:SOMATOSTATIN SST2 SSTR2 MOUSE::P30875
Residue:369
Sequence:
MEMSSEQLNGSQVWVSSPFDLNGSLGPSNGSNQTEPYYDMTSNAVLTFIYFVVCVVGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWCVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVIL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTEDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82469
NameBDBM82469
Synonyms:BIM 23003 | BIM-23003 | EC5-21 | L-Cys(1)-L-Lys-L-Asn-4-Chloro-L-Phe-L-Phe-D-Trp-L-Lys-L-Thr-L-Phe-L-Thr-L-Ser-L-Cys(1)-OH
TypeSmall organic molecule
Emp. Form.C71H95ClN16O17S2
Mol. Mass.1544.194
SMILESC[C@@H](O)[C@@H]1NC(=O)[C@H](CCCCN)NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](Cc2ccc(Cl)cc2)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CSSC[C@H](NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc2ccccc2)NC1=O)[C@@H](C)O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a