Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSSTR5
LigandBDBM82463
Substrate/Competitorn/a
Ki 0.01±n/a nM
CommentsPDSP_1033
Citation Hoyer, DLübbert, HBruns, C Molecular pharmacology of somatostatin receptors. Naunyn Schmiedebergs Arch Pharmacol350:441-53 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
SSTR5
Name:Somatostatin receptor
Synonyms:SOMATOSTATIN SST5 | Somatostatin receptor type 5
Type:Enzyme Catalytic Domain
Mol. Mass.:39986.50
Organism:RAT
Description:SOMATOSTATIN SST5 SSTR5 RAT::P30938
Residue:363
Sequence:
MEPLSLASTPSWNASAASSGNHNWSLVGSASPMGARAVLVPVLYLLVCTVGLSGNTLVIY
VVLRHAKMKTVTNVYILNLAVADVLFMLGLPFLATQNAVVSYWPFGSFLCRLVMTLDGIN
QFTSIFCLMVMSVDRYLAVVHPLRSARWRRPRVAKMASAAVWVFSLLMSLPLLVFADVQE
GWGTCNLSWPEPVGLWGAAFITYTSVLGFFGPLLVICLCYLLIVVKVKAAGMRVGSSRRR
RSEPKVTRMVVVVVLVFVGCWLPFFIVNIVNLAFTLPEEPTSAGLYFFVVVLSYANSCAN
PLLYGFLSDNFRQSFRKVLCLRRGYGMEDADAIEPRPDKSGRPQATLPTRSCEANGLMQT
SRI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82463
NameBDBM82463
Synonyms:Cyclo[L-Trp-D-Trp-L-Lys-L-Thr-L-Phe-(7-amino*heptanoyl-L-Phe-)] | L-362,855 | L-362855
TypeSmall organic molecule
Emp. Form.C57H70N10O8
Mol. Mass.1023.2279
SMILESC[C@@H](O)[C@@H]1NC(=O)[C@H](CCCCN)NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccccc2)NC(=O)CCCCCCNC(=O)[C@H](Cc2ccccc2)NC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a