Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-1 adrenergic receptor
LigandBDBM50019443
Substrate/Competitorn/a
Ki 7.24±n/a nM
CommentsPDSP_1495
Citation Fraundorfer, PFFertel, RHMiller, DDFeller, DR Biochemical and pharmacological characterization of high-affinity trimetoquinol analogs on guinea pig and human beta adrenergic receptor subtypes: evidence for partial agonism. J Pharmacol Exp Ther270:665-74 (1994) [PubMed]
More Info.:Get all data from this article
 
Beta-1 adrenergic receptor
Name:Beta-1 adrenergic receptor
Synonyms:ADRB1 | Adrenergic receptor | adrenergic Beta1
Type:Enzyme Catalytic Domain
Mol. Mass.:50540.48
Organism:GUINEA PIG
Description:adrenergic Beta1 ADRB1 GUINEA PIG::B0FL73
Residue:467
Sequence:
MGAGVLALGASEPCNLSSTAPLPDGAATAARLLVPASPPASLLPPTSEGSEPLSPQWTAG
MGLLMVLIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARVLVC
TVWAISALVSFLPILMHWWRAEGDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPGRPPSPVPSPTPGSPRAATDPLANGRTSKRR
PSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANS
AFNPIIYCRSPDFRKAFQRLLCCARRAARRRHTAHGGRPRASGCLARSGPPPSPGAASDE
DEDAVGAAPPARLLEPWAGCNGGAATADSDWSLDEPGRAGFASESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50019443
NameBDBM50019443
Synonyms:1-(1H-Indol-4-yloxy)-3-isopropylamino-propan-2-ol | 1-(1H-Indol-4-yloxy)-3-isopropylamino-propan-2-ol((-)-Pindolol) | 1-(1H-Indol-4-yloxy)-3-isopropylamino-propan-2-ol(pindolol) | 1-(1H-indol-4-yloxy)-3-(isopropylamino)propan-2-ol | LB-46 | PINDOLOL | PINDOLOL,(-) | PRINODOLOL | VISKAZIDE | VISKEN
TypeSmall organic molecule
Emp. Form.C14H20N2O2
Mol. Mass.248.3208
SMILESCC(C)NCC(O)COc1cccc2[nH]ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a