Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADORA3
LigandBDBM22926
Substrate/Competitorn/a
Ki 57.5±n/a nM
CommentsPDSP_2573
Citation van Galen, PJvan Bergen, AHGallo-Rodriguez, CMelman, NOlah, MEIJzerman, APStiles, GLJacobson, KA A binding site model and structure-activity relationships for the rat A3 adenosine receptor. Mol Pharmacol45:1101-11 (1994) [PubMed]
More Info.:Get all data from this article
 
ADORA3
Name:ADORA3
Synonyms:ADENOSINE A3 | Adora3 protein
Type:Enzyme Catalytic Domain
Mol. Mass.:25707.75
Organism:RAT
Description:Q4V8H0
Residue:232
Sequence:
MEPLLLLSLALFSDAMVMDEKVKSGVELDTASAICNYDAHYKDHTKYWCRGYFRDSCNII
AFTPNSSNRVALKDTGDQLIITVSCLVKEDTGWYWCGIQRDFARDDMDFTKLIVTDNRED
RANGLSPGTSGNRTRSCKTSKAVQKAEGSRMSILIVCVLISGLGIIFLISHMSRGRRSQR
NRGVTGKSINRNPQASQAPSMVSIPLTVLPKVPRQNGQQKALQWTGNATKTG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22926
NameBDBM22926
Synonyms:3-(6-amino-9H-purin-9-yl)nonan-2-ol | EHNA | Erythro-9-(2-hydroxy-3-nonyl)adenine
TypeSmall organic molecule
Emp. Form.C14H23N5O
Mol. Mass.277.3653
SMILESCCCCCCC(C(C)O)n1cnc2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a