Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(3) dopamine receptor
LigandBDBM85091
Substrate/Competitorn/a
Ki 0.68±n/a nM
CommentsPDSP_244
Citation Freedman, SBPatel, SMarwood, REmms, FSeabrook, GRKnowles, MRMcAllister, G Expression and pharmacological characterization of the human D3 dopamine receptor. J Pharmacol Exp Ther268:417-26 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
D(3) dopamine receptor
Name:D(3) dopamine receptor
Synonyms:D2-like dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3
Type:n/a
Mol. Mass.:44243.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:400
Sequence:
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85091
NameBDBM85091
Synonyms:(+/-)-2-DIPROPYLAMINO- 6,7-DIHYDROXY-1,2,3,4-TETRAHYDRONAPHTHALENE | ADTN DIPROPYL 6,7 | CAS_62421-17-4 | CHEMBL15887 | dp-ADTN
TypeSmall organic molecule
Emp. Form.C16H25NO2
Mol. Mass.263.3752
SMILESCCCN(CCC)C1CCc2cc(O)c(O)cc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a