BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta lactamase
LigandBDBM83262
Substrate/Competitorn/a
Meas. Tech.Counterscreen for inhibitors of TLR9-MyD88 binding: fluorescence-based cell-based high throughput dose response assay to identify non-selective inhibitors of the beta-lactamase enzyme (BLA)
IC50 7425±n/a nM
Citation PubChem, PC Counterscreen for inhibitors of TLR9-MyD88 binding: fluorescence-based cell-based high throughput dose response assay to identify non-selective inhibitors of the beta-lactamase enzyme (BLA) PubChem Bioassay(2011)[AID]
More Info.:Get all data from this article,  Assay Method
 
Beta lactamase
Name:Beta lactamase
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:31513.38
Organism:Pseudomonas aeruginosa
Description:gi_114881106
Residue:286
Sequence:
MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRP
EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL
CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS
RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM83262
NameBDBM83262
Synonyms:MLS001065950 | N-butyl-2-(3-hexylsulfanyl-4-methoxy-phenyl)imidazo[1,2-a]pyrazin-3-amine | N-butyl-2-(3-hexylsulfanyl-4-methoxyphenyl)imidazo[1,2-a]pyrazin-3-amine | N-butyl-2-[3-(hexylthio)-4-methoxyphenyl]-3-imidazo[1,2-a]pyrazinamine | SMR000814612 | butyl-[2-[3-(hexylthio)-4-methoxy-phenyl]imidazo[1,2-a]pyrazin-3-yl]amine | cid_42601091
TypeSmall organic molecule
Emp. Form.C23H32N4OS
Mol. Mass.412.591
SMILESCCCCCCSc1cc(ccc1OC)-c1nc2cnccn2c1NCCCC
Structure
n/a