Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 1
LigandBDBM84628
Substrate/Competitorn/a
Ki 382±n/a nM
CommentsPDSP_775
Citation Raynor, KMurphy, WACoy, DHTaylor, JEMoreau, JPYasuda, KBell, GIReisine, T Cloned somatostatin receptors: identification of subtype-selective peptides and demonstration of high affinity binding of linear peptides. Mol Pharmacol43:838-44 (1993) [PubMed]
More Info.:Get all data from this article
 
Somatostatin receptor type 1
Name:Somatostatin receptor type 1
Synonyms:SOMATOSTATIN SST1 | SRIF-2 | SS-1-R | SS1-R | SS1R | SSTR1 | Somatostatin receptor type 1 (SSTR1)
Type:Enzyme
Mol. Mass.:42692.81
Organism:Homo sapiens (Human)
Description:P30872
Residue:391
Sequence:
MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAIL
ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL
RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG
VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC
LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS
RAYSVEDFQPENLESGGVFRNGTCTSRITTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM84628
NameBDBM84628
Synonyms:EC5-21
TypeSmall organic molecule
Emp. Form.C56H66N10O8S2
Mol. Mass.1071.315
SMILESCC(O)C1NC(=O)C(CCCCN)NC(=O)C(Cc2c[nH]c3ccccc23)NC(=O)C(Cc2ccccc2)NC(=O)C(CSSCC(NC1=O)C(=O)NCc1cccc2ccccc12)NC(=O)C(N)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a