Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSSTR2
LigandBDBM84630
Substrate/Competitorn/a
Ki 0.01±n/a nM
CommentsPDSP_389
Citation Raynor, KMurphy, WACoy, DHTaylor, JEMoreau, JPYasuda, KBell, GIReisine, T Cloned somatostatin receptors: identification of subtype-selective peptides and demonstration of high affinity binding of linear peptides. Mol Pharmacol43:838-44 (1993) [PubMed]
More Info.:Get all data from this article
 
SSTR2
Name:Somatostatin receptor
Synonyms:SOMATOSTATIN SST2 | Somatostatin receptor | Somatostatin receptor 2 | Somatostatin receptor type 2
Type:Enzyme Catalytic Domain
Mol. Mass.:41234.26
Organism:MOUSE
Description:SOMATOSTATIN SST2 SSTR2 MOUSE::P30875
Residue:369
Sequence:
MEMSSEQLNGSQVWVSSPFDLNGSLGPSNGSNQTEPYYDMTSNAVLTFIYFVVCVVGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWCVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVIL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTEDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM84630
NameBDBM84630
Synonyms:BIM 23060
TypeSmall organic molecule
Emp. Form.C56H66N10O9S2
Mol. Mass.1087.315
SMILESCC(O)C1NC(=O)C(CCCCN)NC(=O)C(Cc2c[nH]c3ccccc23)NC(=O)C(Cc2ccc(O)cc2)NC(=O)C(CSSCC(NC1=O)C(=O)NCc1cccc2ccccc12)NC(=O)C(N)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a