Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSSTR3
LigandBDBM50097783
Substrate/Competitorn/a
Ki 0.05±n/a nM
CommentsPDSP_1765
Citation Raynor, KMurphy, WACoy, DHTaylor, JEMoreau, JPYasuda, KBell, GIReisine, T Cloned somatostatin receptors: identification of subtype-selective peptides and demonstration of high affinity binding of linear peptides. Mol Pharmacol43:838-44 (1993) [PubMed]
More Info.:Get all data from this article
 
SSTR3
Name:SSTR3
Synonyms:SOMATOSTATIN SST3 | SS3R | SSR-28 | Somatostatin receptor | Somatostatin receptor 3 | Somatostatin receptor type 3
Type:Enzyme Catalytic Domain
Mol. Mass.:47225.49
Organism:MOUSE
Description:SOMATOSTATIN SST3 SSTR3 MOUSE::P30935
Residue:428
Sequence:
MATVTYPSSEPTTLDPGNASSTWPLDTTLGNTSAGASLTGLAVSGILISLVYLVVCVVGL
LGNSLVIYVVLRHTSSPSVTSVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLV
MAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVV
VFSGVPRGMSTCHMQWPEPAAAWRTAFIIYTAALGFFGPLLVICLCYLLIVVKVRSTTRR
VRAPSCQWVQAPACQRRRRSERRVTRMVVAVVALFVLCWMPFYLLNIVNVVCPLPEEPAF
FGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRILLRPSRRIRSQEPGSGPPEKTEEE
EDEEEEERREEEERRMQRGQEMNGRLSQIAQAGTSGQQPRPCTGTAKEQQLLPQEATAGD
KASTLSHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50097783
NameBDBM50097783
Synonyms:CHEMBL438401 | D-Trp8 SST-14 | SOMATOSTATIN | SRIF-D-Trp8
TypeSmall organic molecule
Emp. Form.C76H104N18O19S2
Mol. Mass.1637.878
SMILESC[C@@H](O)[C@@H]1NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@@H](NC(=O)[C@@H](CCCCN)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CSSC[C@@H](NC(=O)[C@@H](CO)NC1=O)C(O)=O)NC(=O)CNC(=O)[C@H](C)N)C(C)O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a