Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D2 receptor/Serotonin 2 (5-HT2) receptor
LigandBDBM50007518
Substrate/Competitorn/a
Ki 0.02±n/a nM
CommentsPDSP_802
Citation Tang, LTodd, RDHeller, AO'Malley, KL Pharmacological and functional characterization of D2, D3 and D4 dopamine receptors in fibroblast and dopaminergic cell lines. J Pharmacol Exp Ther268:495-502 (1994) [PubMed]
More Info.:Get all data from this article
 
Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
Name:Dopamine D2 receptor and Serotonin 2a receptor (D2 and 5HT2a)
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DOPAMINE D2/D4 | DRD2 | Dopamine D2 receptor | Dopamine2-like
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:50931.60
Organism:Rattus norvegicus (rat)
Description:Receptor binding assays were performed using rat striatal membranes.
Residue:444
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50007518
NameBDBM50007518
Synonyms:(S)-3-chloro-5-ethyl-N-((1-ethylpyrrolidin-2-yl)methyl)-6-hydroxy-2-methoxybenzamide | 3,5-Dichloro-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2-hydroxy-6-methoxy-benzamide | 3-Chloro-5-ethyl-N-((S)-1-ethyl-pyrrolidin-2-ylmethyl)-6-hydroxy-2-methoxy-benzamide | 3-Chloro-5-ethyl-N-(1-ethyl-pyrrolidin-2-ylmethyl)-6-hydroxy-2-methoxy-benzamide | 3-Chloro-5-ethyl-N-(1-ethyl-pyrrolidin-2-ylmethyl)-6-hydroxy-2-methoxy-benzamide (etichlopride) | 3-Chloro-5-ethyl-N-(1-ethyl-pyrrolidin-2-ylmethyl)-6-hydroxy-2-methoxy-benzamide(Eticlopride) | 3-chloro-5-ethyl-N-{[(2S)-1-ethylpyrrolidin-2-yl]methyl}-6-hydroxy-2-methoxybenzamide | CHEMBL8946 | ETICLOPRIDE | ETICLOPRIDE,S(-) | Eticlopride;3-Chloro-5-ethyl-N-(1-ethyl-pyrrolidin-2-ylmethyl)-6-hydroxy-2-methoxy-benzamide
TypeSmall organic molecule
Emp. Form.C17H25ClN2O3
Mol. Mass.340.845
SMILESCCN1CCC[C@H]1CNC(=O)c1c(O)c(CC)cc(Cl)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a