Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDelta-type opioid receptor
LigandBDBM50000799
Substrate/Competitorn/a
Meas. Tech.ChEBML_145772
IC50 15±n/a nM
Citation Toth, GRussell, KCLandis, GKramer, THFang, LKnapp, RDavis, PBurks, TFYamamura, HIHruby, VJ Ring substituted and other conformationally constrained tyrosine analogues of [D-Pen2,D-Pen5]enkephalin with delta opioid receptor selectivity. J Med Chem35:2384-91 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Delta-type opioid receptor
Name:Opioid receptor
Synonyms:DOR-1 | Delta-type opioid receptor | K56 | MSL-2 | OPIATE Delta | OPRD1
Type:Enzyme Catalytic Domain
Mol. Mass.:40577.25
Organism:MOUSE
Description:OPIATE Delta OPRD1 MOUSE::P32300
Residue:372
Sequence:
MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRRPRQATTRERVTAC
TPSDGPGGGAAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50000799
NameBDBM50000799
Synonyms:13-[2-Amino-3-(4-hydroxy-phenyl)-butyrylamino]-7-benzyl-3,3,14,14-tetramethyl-6,9,12-trioxo-1,2-dithia-5,8,11-triaza-cyclotetradecane-4-carboxylic acid | CHEMBL310681
TypeSmall organic molecule
Emp. Form.C31H41N5O7S2
Mol. Mass.659.817
SMILESC[C@@H]([C@H](N)C(=O)N[C@H]1C(=O)NCC(=O)N[C@@H](Cc2ccccc2)C(=O)N[C@@H](C(O)=O)C(C)(C)SSC1(C)C)c1ccc(O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a