Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProlyl 4-hydroxylase alpha-1 subunit
LigandBDBM50000864
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157457
IC50 414000±n/a nM
Citation Cunliffe, CJFranklin, TJHales, NJHill, GB Novel inhibitors of prolyl 4-hydroxylase. 3. Inhibition by the substrate analogue N-oxaloglycine and its derivatives. J Med Chem35:2652-8 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prolyl 4-hydroxylase alpha-1 subunit
Name:Prolyl 4-hydroxylase alpha-1 subunit
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:60891.28
Organism:Rattus norvegicus
Description:ChEMBL_157460
Residue:534
Sequence:
MIWGVLMMGILLPQCSAHPGFFTSIGQMTDLIHNEKDLVTSLKDYIKAEEDKLEQIKKWA
EKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLILKDMSDGFISNLTIQRQY
FPNDEDQVGAAKALFRLQDTYNLDTNTISKGNLPGVKHKSFLTAEDCFELGKVAYTEADY
YHTELWMEQALMQLEEGEMSTVDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQR
ANGNLVYFEYIMSKEKDANKSASGDQSDQKTTPKKKGIAVDYLPERQKYEMLCRGEGIKM
TPRRQKRLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPRL
SRATVHDPETGKLTTAQYRVSKSAWLSGYEDPVVSRINMRIQDLTGLDVSTAEELQVANY
GVGGQYEPHFDFARKDEPDAFRELGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKG
TAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWLHERGQEFRRPCTLSELE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50000864
NameBDBM50000864
Synonyms:CHEMBL314175 | N-(2-Methanesulfonylamino-2-oxo-ethyl)-oxalamic acid
TypeSmall organic molecule
Emp. Form.C5H8N2O6S
Mol. Mass.224.192
SMILESCS(=O)(=O)NC(=O)CNC(=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a