Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene B4 receptor
LigandBDBM50001649
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157910
IC50 200±n/a nM
Citation Labaudinière, RDereu, NCavy, FGuillet, MCMarquis, OTerlain, B omega-[(4,6-Diphenyl-2-pyridyl)oxy]alkanoic acid derivatives: a new family of potent and orally active LTB4 antagonists. J Med Chem35:4315-24 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leukotriene B4 receptor
Name:Leukotriene B4 receptor
Synonyms:Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | LTB4-R 1 | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2Y purinoceptor 7 | P2Y7
Type:Enzyme Catalytic Domain
Mol. Mass.:37582.68
Organism:Homo sapiens (Human)
Description:Leukotriene B4 R1 LTB4R HUMAN::Q15722
Residue:352
Sequence:
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001649
NameBDBM50001649
Synonyms:2,4-Diphenyl-6-(5-tetrazol-1-yl-pentyloxy)-pyridine | CHEMBL136243
TypeSmall organic molecule
Emp. Form.C23H23N5O
Mol. Mass.385.4616
SMILESC(CCOc1cc(cc(n1)-c1ccccc1)-c1ccccc1)CCn1cnnn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a