Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPepsin A
LigandBDBM50002975
Substrate/Competitorn/a
Meas. Tech.ChEBML_222284
IC50 4500±n/a nM
Citation Raddatz, PJonczyk, AMinck, KORippmann, FSchittenhelm, CSchmitges, CJ Renin inhibitors containing new P1-P1' dipeptide mimetics with heterocycles in P1'. J Med Chem35:3525-36 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pepsin A
Name:Pepsin A
Synonyms:Pepsin | Pepsin A precursor
Type:Enzyme
Mol. Mass.:41232.87
Organism:Porcine
Description:n/a
Residue:385
Sequence:
MKWLLLLSLVVLSECLVKVPLVRKKSLRQNLIKNGKLKDFLKTHKHNPASKYFPEAAALI
GDEPLENYLDTEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDS
STFEATSQELSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGIL
GLAYPSISASGATPVFDNLWDQGLVSQDLFSVYLSSNDDSGSVVLLGGIDSSYYTGSLNW
VPVSVEGYWQITLDSITMDGETIACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASENS
DGEMVISCSSIDSLPDIVFTINGVQYPLSPSAYILQDDDSCTSGFEGMDVPTSSGELWIL
GDVFIRQYYTVFDRANNKVGLAPVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002975
NameBDBM50002975
Synonyms:4-Amino-piperidine-1-carboxylic acid 1-{1-[1-cyclohexylmethyl-2-hydroxy-4-(pyridin-2-ylsulfanyl)-butylcarbamoyl]-butylcarbamoyl}-2-phenyl-ethyl ester | CHEMBL325721
TypeSmall organic molecule
Emp. Form.C36H53N5O5S
Mol. Mass.667.902
SMILESCCCC(NC(=O)[C@H](Cc1ccccc1)OC(=O)N1CCC(N)CC1)C(=O)N[C@@H](CC1CCCCC1)[C@@H](O)CCSc1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a