Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin D
LigandBDBM50002979
Substrate/Competitorn/a
Meas. Tech.ChEBML_44973
IC50>10000±n/a nM
Citation Raddatz, PJonczyk, AMinck, KORippmann, FSchittenhelm, CSchmitges, CJ Renin inhibitors containing new P1-P1' dipeptide mimetics with heterocycles in P1'. J Med Chem35:3525-36 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin D
Name:Cathepsin D
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:42158.92
Organism:Bos taurus
Description:ChEMBL_1458606
Residue:387
Sequence:
VIRIPLHKFTSIRRTMSEAAGVLIAKGPISKYATGEPAVRQGPIPELLKNYMDAQYYGEI
GIGTPPQCFTVVFDTGSANLWVPSIHCKLLDIACWTHRKYNSDKSSTYVKNGTTFDIHYG
SGSLSGYLSQDTVSVPCNPSSSSPGGVTVQRQTFGEAIKQPGVVFIAAKFDGILGMAYPR
ISVNNVLPVFDNLMQQKLVDKNVFSFFLNRDPKAQPGGELMLGGTDSKYYRGSLMFHNVT
RQAYWQIHMDQLDVGSSLTVCKGGCEAIVDTGTSLIVGPVEEVRELQKAIGAVPLIQGEY
MIPCEKVSSLPEVTVKLGGKDYALSPEDYALKVSQAETTVCLSGFMGMDIPPPGGPLWIL
GDVFIGRYYTVFDRDQNRVGLAEAARL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002979
NameBDBM50002979
Synonyms:4-Amino-piperidine-1-carboxylic acid 1-{1-[1-cyclohexylmethyl-2-hydroxy-4-(1-methyl-1H-tetrazol-5-ylsulfanyl)-butylcarbamoyl]-2-methylsulfanyl-ethylcarbamoyl}-2-phenyl-ethyl ester | CHEMBL421050
TypeSmall organic molecule
Emp. Form.C32H50N8O5S2
Mol. Mass.690.92
SMILESCSC[C@H](NC(=O)[C@H](Cc1ccccc1)OC(=O)N1CCC(N)CC1)C(=O)N[C@@H](CC1CCCCC1)[C@@H](O)CCSc1nnnn1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a