Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin D
LigandBDBM50002974
Substrate/Competitorn/a
Meas. Tech.ChEBML_44973
IC50>10000±n/a nM
Citation Raddatz, PJonczyk, AMinck, KORippmann, FSchittenhelm, CSchmitges, CJ Renin inhibitors containing new P1-P1' dipeptide mimetics with heterocycles in P1'. J Med Chem35:3525-36 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin D
Name:Cathepsin D
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:42158.92
Organism:Bos taurus
Description:ChEMBL_1458606
Residue:387
Sequence:
VIRIPLHKFTSIRRTMSEAAGVLIAKGPISKYATGEPAVRQGPIPELLKNYMDAQYYGEI
GIGTPPQCFTVVFDTGSANLWVPSIHCKLLDIACWTHRKYNSDKSSTYVKNGTTFDIHYG
SGSLSGYLSQDTVSVPCNPSSSSPGGVTVQRQTFGEAIKQPGVVFIAAKFDGILGMAYPR
ISVNNVLPVFDNLMQQKLVDKNVFSFFLNRDPKAQPGGELMLGGTDSKYYRGSLMFHNVT
RQAYWQIHMDQLDVGSSLTVCKGGCEAIVDTGTSLIVGPVEEVRELQKAIGAVPLIQGEY
MIPCEKVSSLPEVTVKLGGKDYALSPEDYALKVSQAETTVCLSGFMGMDIPPPGGPLWIL
GDVFIGRYYTVFDRDQNRVGLAEAARL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002974
NameBDBM50002974
Synonyms:4-Amino-piperidine-1-carboxylic acid 1-[1-[1-cyclohexylmethyl-2-hydroxy-4-(pyridin-2-ylsulfanyl)-butylcarbamoyl]-2-(1H-imidazol-4-yl)-ethylcarbamoyl]-2-phenyl-ethyl ester | CHEMBL118421
TypeSmall organic molecule
Emp. Form.C37H51N7O5S
Mol. Mass.705.91
SMILESNC1CCN(CC1)C(=O)O[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](CC1CCCCC1)[C@@H](O)CCSc1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a