Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine A1 receptor
LigandBDBM50003023
Substrate/Competitorn/a
Meas. Tech.ChEMBL_29419
Ki 5.7±n/a nM
Citation Suzuki, FShimada, JNonaka, HIshii, AShiozaki, SIchikawa, SOno, E 7,8-Dihydro-8-ethyl-2-(3-noradamantyl)-4-propyl-1H-imidazo[2,1-i]purin-5(4H)-one: a potent and water-soluble adenosine A1 antagonist. J Med Chem35:3578-81 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine A1 receptor
Name:Adenosine A1 receptor
Synonyms:A1 adenosine receptor | ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | ADORA1 | Adenosine Receptor A1
Type:Enzyme Catalytic Domain
Mol. Mass.:36501.39
Organism:GUINEA PIG
Description:ADENOSINE A1 ADORA1 GUINEA PIG::P47745
Residue:326
Sequence:
MPHSVSAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIASLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
PRRAAVAIAGCWILSLVVGLTPMFGWNNLSKIEMAWAANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLSKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCHKPTILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPEPPIDEDLPEEKVDD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003023
NameBDBM50003023
Synonyms:7-Ethyl-2-(hexahydro-2,5-methano-pentalen-3a-yl)-4-propyl-1,4,6,7-tetrahydro-1,3,4,5a,8-pentaaza-as-indacen-5-one | CHEMBL312352
TypeSmall organic molecule
Emp. Form.C21H29N5O
Mol. Mass.367.4879
SMILESCCCn1c2nc(nc2c2NC(CC)Cn2c1=O)C12CC3CC1CC(C2)C3 |THB:23:22:19:25.24.26,23:24:19:22.21|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a