Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThromboxane A2 Synthase (P450 TxA2)
LigandBDBM50003775
Substrate/Competitorn/a
Meas. Tech.ChEBML_209946
IC50 100±n/a nM
Citation Main, AJBhagwat, SSBoswell, CGoldstein, RGude, CCohen, DSFurness, PLee, WLouzan, M Thromboxane receptor antagonism combined with thromboxane synthase inhibition. 3. Pyridinylalkyl-substituted 8-[(arylsulfonyl)amino]octanoic acids. J Med Chem35:4366-72 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thromboxane A2 Synthase (P450 TxA2)
Name:Thromboxane-A synthase
Synonyms:Cytochrome P450 5A1 | P450 TxA2 | TXA synthase | TXS | Thromboxane A2 Synthase | Thromboxane Alpha | Thromboxane prostanoid | Thromboxane synthase | Thromboxane-A synthase
Type:Enzyme
Mol. Mass.:60524.67
Organism:Homo sapiens (Human)
Description:P24557
Residue:533
Sequence:
MEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFR
QGFWESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSV
ADSVLFLRDKRWEEVRGALMSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQR
CYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIPRPILVLLLSFPSIMVPLA
RILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIV
RDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLATN
PDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEV
LGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCL
GVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003775
NameBDBM50003775
Synonyms:8-(4-Chloro-benzenesulfonylamino)-3-(4-pyridin-3-yl-butyl)-octanoic acid | CHEMBL136905
TypeSmall organic molecule
Emp. Form.C23H31ClN2O4S
Mol. Mass.467.021
SMILESOC(=O)CC(CCCCCNS(=O)(=O)c1ccc(Cl)cc1)CCCCc1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a