Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThromboxane A2 Synthase (P450 TxA2)
LigandBDBM50003804
Substrate/Competitorn/a
Meas. Tech.ChEBML_209924
IC50 7.0±n/a nM
Citation Bhagwat, SSGude, CBoswell, CContardo, NCohen, DSDotson, RMathis, JLee, WFurness, PZoganas, H Thromboxane receptor antagonism combined with thromboxane synthase inhibition. 4. 8-[[(4-Chlorophenyl)sulfonyl]amino]-4-(3-(3-pyridinyl) propyl)octanoic acid and analogs. J Med Chem35:4373-83 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thromboxane A2 Synthase (P450 TxA2)
Name:Thromboxane-A synthase
Synonyms:Cytochrome P450 5A1 | P450 TxA2 | TXA synthase | TXS | Thromboxane A2 Synthase | Thromboxane Alpha | Thromboxane prostanoid | Thromboxane synthase | Thromboxane-A synthase
Type:Enzyme
Mol. Mass.:60524.67
Organism:Homo sapiens (Human)
Description:P24557
Residue:533
Sequence:
MEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFR
QGFWESQMELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSV
ADSVLFLRDKRWEEVRGALMSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQR
CYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFFEFCIPRPILVLLLSFPSIMVPLA
RILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFLQMVLDARHSASPMGVQDFDIV
RDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLATN
PDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCEV
LGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCL
GVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003804
NameBDBM50003804
Synonyms:7-(4-Chloro-benzenesulfonylamino)-3-(3-pyridin-3-yl-propyl)-heptanoic acid | CHEMBL345105
TypeSmall organic molecule
Emp. Form.C21H27ClN2O4S
Mol. Mass.438.968
SMILESOC(=O)CC(CCCCNS(=O)(=O)c1ccc(Cl)cc1)CCCc1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a