Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylcholinesterase and butyrylcholinesterase (AChE and BChE)
LigandBDBM9409
Substrate/Competitorn/a
Meas. Tech.ChEBML_41575
IC50 10100±n/a nM
Citation Sugimoto, HTsuchiya, YSugumi, HHigurashi, KKaribe, NIimura, YSasaki, AAraki, SYamanishi, YYamatsu, K Synthesis and structure-activity relationships of acetylcholinesterase inhibitors: 1-benzyl-4-(2-phthalimidoethyl)piperidine and related derivatives. J Med Chem35:4542-8 (1993) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acetylcholinesterase and butyrylcholinesterase (AChE and BChE)
Name:Acetylcholinesterase and butyrylcholinesterase (AChE and BChE)
Synonyms:BuChE | Butyrylcholinesterase (BuChE) | butyrylcholinesterase precursor
Type:Enzyme
Mol. Mass.:67776.22
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:597
Sequence:
MVTEIHFLLWILLLCMLFGKSHTEEDVIITTKTGRVRGLSMPILGGTVTAFLGIPYAQPP
LGSLRFKKPQPLNKWPDVYNATKYANSCYQNIDQAFPGFQGSEMWNPNTNLSEDCLYLNV
WIPVPKPKNATVMVWVYGGGFQTGTSSLPVYDGKFLTRVERVIVVSMNYRVGALGFLAFP
GNSEAPGNMGLFDQQLALQWIQRNIAAFGGNPKSVTLFGESAGAASVSLHLLCPQSYPLF
TRAILESGSSNAPWAVKHPEEARNRTLTLAKFIGCSKENEKEIITCLRSKDPQEILLNEK
LVLPSDSIRSINFGPTVDGDFLTDMPHTLLQLGKVKTAQILVGVNKDEGTAFLVYGAPGF
SKDNDSLITRREFQEGLNMYFPGVSSLGKEAILFYYVDWLGDQTPEVYREAFDDIIGDYN
IICPALEFTKKFAELEINAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERRVNYT
RAEEIFSRSIMKTWANFAKYGHPNGTQGNSTVWPVFTSTEQKYLTLNTEKSKINSKLRAP
QCQFWRLFFPKVLEITGDIDEREQEWKAGFHRWSNYMMDWKNQFNDYTSKKETCTDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM9409
NameBDBM9409
Synonyms:CHEMBL299708 | N-[2-(1-benzylpiperidin-4-yl)ethyl]-4-(benzylsulfonyl)-N-methylbenzamide Hydrochloride | N-[2-(1-benzylpiperidin-4-yl)ethyl]-N-methyl-4-(phenylmethane)sulfonylbenzamide hydrochloride | Piperidine Derivative 21
TypeSmall organic molecule
Emp. Form.C29H34N2O3S
Mol. Mass.490.657
SMILESCN(CCC1CCN(Cc2ccccc2)CC1)C(=O)c1ccc(cc1)S(=O)(=O)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a