Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin receptor
LigandBDBM50004492
Substrate/Competitorn/a
Meas. Tech.ChEMBL_70879
EC50 71±n/a nM
Citation Holladay, MWBennett, MJTufano, MDLin, CWAsin, KEWitte, DGMiller, TRBianchi, BRNikkel, ALBednarz, L Synthesis and biological activity of CCK heptapeptide analogues. Effects of conformational constraints and standard modifications on receptor subtype selectivity, functional activity in vitro, and appetite suppression in vivo. J Med Chem35:2919-28 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cholecystokinin receptor
Name:Cholecystokinin receptor
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 357790
Components:This complex has 2 components.
Component 1
Name:Cholecystokinin receptor
Synonyms:CCK-A receptor | CCK-AR | CCK1-R | Cholecystokinin receptor type A | Cholecystokinin-1 Receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:47859.34
Organism:Homo sapiens (Human)
Description:Stable expression of human CCK-1 receptors in HEK 293 cells.
Residue:428
Sequence:
MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSSRANRIRSNS
SAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSY
TSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSH
MSASVPPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Cholecystokinin receptor
Synonyms:CCK-2 receptor | CCK-B receptor | CCK-BR | CCKBR | Cholecystokinin A | Cholecystokinin-2 Receptor | Gastrin/cholecystokinin type B receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48445.79
Organism:Homo sapiens (Human)
Description:Stable expression of human CCK-2 receptors in HEK 293 cells.
Residue:447
Sequence:
MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITL
YAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWL
LSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGL
ISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRS
RPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDG
PGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRAL
PDEDPPTPSIASLSRLSYTTISTLGPG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004492
NameBDBM50004492
Synonyms:CCK7 analogue | CHEMBL98720
TypeSmall organic molecule
Emp. Form.C45H54N8O13S
Mol. Mass.947.021
SMILESCCCC[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CN1CC[C@H](NC(=O)CCc2ccc(OS(O)(=O)=O)cc2)C1=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a