Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid TP receptor
LigandBDBM50005113
Substrate/Competitorn/a
Meas. Tech.ChEBML_209761
IC50 200±n/a nM
Citation Fukumoto, SShiraishi, MTerashita, ZAshida, YInada, Y Synthesis and thromboxane A2/prostaglandin H2 receptor antagonistic activity of phenol derivatives. J Med Chem35:2202-9 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid TP receptor
Name:Thromboxane A2 receptor
Synonyms:TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta
Type:Enyzme
Mol. Mass.:37445.28
Organism:Homo sapiens (Human)
Description:P21731
Residue:343
Sequence:
MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50005113
NameBDBM50005113
Synonyms:7-(2,5-Dihydroxy-3,4,6-trimethyl-phenyl)-7-(4-fluoro-phenyl)-heptanoic acid | CHEMBL70314
TypeSmall organic molecule
Emp. Form.C22H27FO4
Mol. Mass.374.4458
SMILESCc1c(C)c(O)c(C(CCCCCC(O)=O)c2ccc(F)cc2)c(C)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a