Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosylhomocysteinase
LigandBDBM50006218
Substrate/Competitorn/a
Meas. Tech.ChEBML_196726
Ki 12±n/a nM
Citation Wolfe, MSLee, YBartlett, WJBorcherding, DRBorchardt, RT 4'-modified analogues of aristeromycin and neplanocin A: synthesis and inhibitory activity toward S-adenosyl-L-homocysteine hydrolase. J Med Chem35:1782-91 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosylhomocysteinase
Name:Adenosylhomocysteinase
Synonyms:Adenosylhomocysteinase
Type:PROTEIN
Mol. Mass.:47714.06
Organism:Homo sapiens (Human)
Description:ChEMBL_1507791
Residue:432
Sequence:
MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVET
AVLIETLVTLGAEVQWSSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYF
KDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINV
NDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIG
HFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSN
SFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMS
CDGPFKPDHYRY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50006218
NameBDBM50006218
Synonyms:(1R,2S,3R)-3-(6-amino-9H-purin-9-yl)cyclopentane-1,2-diol | 3-(6-Amino-purin-9-yl)-cyclopentane-1,2-diol | CHEMBL301499
TypeSmall organic molecule
Emp. Form.C10H13N5O2
Mol. Mass.235.2425
SMILESNc1ncnc2n(cnc12)[C@@H]1CC[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a