Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose reductase (AR)
LigandBDBM50006392
Substrate/Competitorn/a
Meas. Tech.ChEBML_31912
IC50 72.0±n/a nM
Citation Yamagishi, MYamada, YOzaki, KAsao, MShimizu, RSuzuki, MMatsumoto, MMatsuoka, YMatsumoto, K Biological activities and quantitative structure-activity relationships of spiro[imidazolidine-4,4'(1'H)-quinazoline]-2,2',5(3'H)-triones as aldose reductase inhibitors. J Med Chem35:2085-94 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldose reductase (AR)
Name:Aldose reductase
Synonyms:AR | Aldo-keto reductase family 1 member B1 (AKR1B1) | Aldose Reductase (ALR2) | Aldose reductase
Type:Protein
Mol. Mass.:35855.50
Organism:Homo sapiens (Human)
Description:P15121. 4LAU; 2IKI; 4LB4; 2FZD; 2FZ8; 1US0
Residue:316
Sequence:
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50006392
NameBDBM50006392
Synonyms:6',8'-dichloro-7'-methoxy-3'-methyl-1'H,2H,5H-spiro[imidazolidine-4,4'-quinazoline]-2,2',5(3'H)-trione | CHEMBL292998
TypeSmall organic molecule
Emp. Form.C12H10Cl2N4O4
Mol. Mass.345.138
SMILESCOc1c(Cl)cc2c(NC(=O)N(C)C22NC(=O)NC2=O)c1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a