Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50406676
Substrate/Competitorn/a
Meas. Tech.ChEMBL_159303
IC50 8600±n/a nM
Citation Tucker, TJLumma, WCPayne, LSWai, JMde Solms, SJGiuliani, EADarke, PLHeimbach, JCZugay, JASchleif, WA A series of potent HIV-1 protease inhibitors containing a hydroxyethyl secondary amine transition state isostere: synthesis, enzyme inhibition, and antiviral activity. J Med Chem35:2525-33 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50406676
NameBDBM50406676
Synonyms:CHEMBL2115206
TypeSmall organic molecule
Emp. Form.C33H41N3O6
Mol. Mass.575.6951
SMILESCC(C)(C)OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CNC(C(O)c1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a