Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTACR2
LigandBDBM50007823
Substrate/Competitorn/a
Meas. Tech.ChEBML_209224
EC50 188±n/a nM
Citation Ward, PEwan, GBJordan, CCIreland, SJHagan, RMBrown, JR Potent and highly selective neurokinin antagonists. J Med Chem33:1848-51 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
TACR2
Name:Neurokinin 2 receptor
Synonyms:NK-2 receptor | NK-2R | Neurokinin 2 receptor | Neurokinin A receptor | Neurokinin NK2 | SKR | Substance-K receptor | Tachykinin receptor 2
Type:Enzyme Catalytic Domain
Mol. Mass.:43868.63
Organism:mouse
Description:Neurokinin NK2 TACR2 Murine::P16610
Residue:390
Sequence:
MGTRAIVSDANILSGLESNATGVTAFSMPGWQLALWATAYLALVLVAVTGNATVIWIILA
HERMRTVTNYFIINLALADLCMAAFNATFNFIYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPSTKAIIAGIWLVALALASPQCFYSTITVDEGATK
CVVAWPNDNGGKMLLLYHLVVFVLIYFLPLLVMFGAYSVIGLTLWKRAVPRHQAHGANLR
HLQAKKKFVKAMVLVVLTFAICWLPYHLYFILGTFQEDIYYHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTEEDRLELTHTPSLSRRVNRCHTKETLFMT
GDMTHSEATNGQVGSPQDGEPAGPICKAQA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50007823
NameBDBM50007823
Synonyms:1-{2-[2-(4-Amino-butyrylamino)-3-phenyl-propionylamino]-3-phenyl-propionyl}-pyrrolidine-2-carboxylic acid [1-(1-carbamoyl-3-methylsulfanyl-propylcarbamoyl)-3-methyl-butyl]-amide | CHEMBL2372953
TypeSmall organic molecule
Emp. Form.C38H55N7O6S
Mol. Mass.737.952
SMILESCSCC[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)CCCN)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a