Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin A receptor
LigandBDBM50007977
Substrate/Competitorn/a
Meas. Tech.ChEBML_49571
IC50 16±n/a nM
Citation Shiosaki, KLin, CWKopecka, HTufano, MDBianchi, BRMiller, TRWitte, DGNadzan, AM Boc-CCK-4 derivatives containing side-chain ureas as potent and selective CCK-a receptor agonists. J Med Chem34:2837-42 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cholecystokinin A receptor
Name:Cholecystokinin A receptor
Synonyms:CCK-A receptor | CCK-AR | CCK1-R | CCKAR | Cholecystokinin receptor type A | Cholecystokinin-1 receptor
Type:n/a
Mol. Mass.:48229.77
Organism:Cavia porcellus
Description:n/a
Residue:430
Sequence:
MDVVDSLFVNGSNITSACELGFENETLFCLDRPRPSKEWQPAVQILLYSLIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPSLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNNNQTGNMCRFLLPNDVMQQTWHTFLLLILFLIPGIVMMVAYGLISLELYQGI
KFDAIQKKSAKERKTSTGSSGPMEDSDGCYLQKSRHPRKLELRQLSPSSSGSNRINRIRS
SSSTANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAERHLSGTPISFILLL
SYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGTPGVRGEMGEEEEGRTTGASLSRYSY
SHMSTSAPPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50007977
NameBDBM50007977
Synonyms:3-[2-[2-tert-Butoxycarbonylamino-3-(1H-indol-3-yl)-propionylamino]-6-(3-naphthalen-1-yl-ureido)-hexanoylamino]-N-(1-carbamoyl-2-phenyl-ethyl)-succinamic acid | CHEMBL3142705 | CHEMBL330043
TypeSmall organic molecule
Emp. Form.C46H54N8O9
Mol. Mass.862.9692
SMILESCC(C)(C)OC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCNC(=O)Nc1cccc2ccccc12)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(N)=O
Structure
n/a