Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC5a anaphylatoxin chemotactic receptor (C5aR)
LigandBDBM50008226
Substrate/Competitorn/a
Meas. Tech.ChEBML_41471
Ki 210000±n/a nM
Citation Kawai, MQuincy, DALane, BMollison, KWOr, YSLuly, JRCarter, GW Structure-function studies in a series of carboxyl-terminal octapeptide analogues of anaphylatoxin C5a. J Med Chem35:220-3 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C5a anaphylatoxin chemotactic receptor (C5aR)
Name:C5a anaphylatoxin chemotactic receptor
Synonyms:C5a anaphylatoxin chemotactic receptor | C5a-R | C5aR | CD_antigen=CD88
Type:Enzyme
Mol. Mass.:39347.68
Organism:Homo sapiens (Human)
Description:P21730
Residue:350
Sequence:
MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVW
VTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNM
YASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREE
YFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKT
LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIY
VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50008226
NameBDBM50008226
Synonyms:2-[2-(2-{2-[2-(2-{2-[2-Acetylamino-3-(3H-imidazol-4-yl)-propionylamino]-6-amino-hexanoylamino}-3-carboxy-propionylamino)-3-cyclohexyl-propionylamino]-3-cyclohexyl-propionylamino}-4-methyl-pentanoylamino)-propionylamino]-5-guanidino-pentanoic acid | CHEMBL2369494
TypeSmall organic molecule
Emp. Form.C44H76N14O12
Mol. Mass.993.1608
SMILESCCCC[C@H](NC(=O)[C@H](CCCC)NC(=O)[C@H](CCCC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]cn1)NC(C)=O)C(=O)NCC(=O)N[C@@H](CCCN=C(N)N)C(O)=O |r,wU:24.24,41.41,8.8,wD:16.16,32.32,4.3,59.60,(27.54,-15.73,;26.18,-14.99,;26.15,-13.44,;24.8,-12.7,;24.76,-11.16,;23.42,-10.42,;22.1,-11.22,;22.13,-12.75,;20.75,-10.48,;20.72,-8.94,;22.04,-8.15,;22,-6.6,;20.65,-5.86,;19.43,-11.27,;18.08,-10.53,;18.06,-9,;16.77,-11.33,;16.8,-12.88,;18.16,-13.62,;18.19,-15.16,;19.54,-15.9,;15.42,-10.59,;14.1,-11.38,;14.14,-12.93,;12.75,-10.64,;12.72,-9.11,;14.04,-8.31,;15.38,-9.05,;14.01,-6.78,;11.44,-11.45,;10.09,-10.7,;10.05,-9.16,;8.78,-11.51,;8.81,-13.04,;10.16,-13.79,;10.18,-15.32,;11.53,-16.06,;11.57,-17.6,;7.43,-10.77,;6.11,-11.56,;6.14,-13.1,;4.76,-10.82,;4.72,-9.28,;6.04,-8.48,;7.46,-9.08,;8.46,-7.92,;7.67,-6.59,;6.17,-6.94,;3.45,-11.62,;2.1,-10.88,;.78,-11.67,;2.06,-9.34,;26.09,-10.37,;26.06,-8.83,;27.44,-11.11,;28.75,-10.31,;30.1,-11.05,;30.13,-12.59,;31.41,-10.26,;32.76,-11,;32.79,-12.53,;34.14,-13.27,;34.18,-14.81,;35.53,-15.56,;35.56,-17.09,;36.91,-17.83,;34.24,-17.9,;34.08,-10.2,;35.43,-10.94,;34.05,-8.66,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a