Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetmu/kappa opioid receptor
LigandBDBM50008897
Substrate/Competitorn/a
Meas. Tech.ChEBML_146536
Ki 0.840000±n/a nM
Citation Vecchietti, VGiordani, AGiardina, GColle, RClarke, GD (2S)-1-(arylacetyl)-2-(aminomethyl)piperidine derivatives: novel, highly selective kappa opioid analgesics. J Med Chem34:397-403 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
mu/kappa opioid receptor
Name:mu/kappa opioid receptor
Synonyms:Kappa Opioid Receptor | Kappa-type opioid receptor | OPIATE Kappa | Opiate Kappa 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42744.99
Organism:Cavia porcellus (domestic guinea pig)
Description:The guinea pig brain membrane was used in binding assay.
Residue:380
Sequence:
MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRV
RNTVQDPAYMRNVDGVNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50008897
NameBDBM50008897
Synonyms:2-(4-Bromo-phenyl)-1-(2-pyrrolidin-1-ylmethyl-piperidin-1-yl)-ethanone(HCl) | CHEMBL130125
TypeSmall organic molecule
Emp. Form.C18H25BrN2O
Mol. Mass.365.308
SMILESBrc1ccc(CC(=O)N2CCCCC2CN2CCCC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a