Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM50009706
Substrate/Competitorn/a
Meas. Tech.ChEBML_28553
IC50 20100±n/a nM
Citation Harden, FAQuinn, RJScammells, PJ Synthesis and adenosine receptor affinity of a series of pyrazolo[3,4-d]pyrimidine analogues of 1-methylisoguanosine. J Med Chem34:2892-8 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptors A1
Type:Protein
Mol. Mass.:36704.13
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:326
Sequence:
MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009706
NameBDBM50009706
Synonyms:4-Amino-5-ethyl-1-phenyl-1,5-dihydro-pyrazolo[3,4-d]pyrimidin-6-one | CHEMBL95590
TypeSmall organic molecule
Emp. Form.C13H13N5O
Mol. Mass.255.2752
SMILESCCn1c(N)c2cnn(-c3ccccc3)c2nc1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a