Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose reductase
LigandBDBM50009985
Substrate/Competitorn/a
Meas. Tech.ChEBML_32094
IC50 560.0±n/a nM
Citation DeRuiter, JDavis, RAWandrekar, VGMayfield, CA Relative structure-inhibition analyses of the N-benzoyl and N-(phenylsulfonyl) amino acid aldose reductase inhibitors. J Med Chem34:2120-6 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldose reductase
Name:Aldose reductase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:35797.87
Organism:Rattus norvegicus
Description:ChEMBL_1512484
Residue:316
Sequence:
MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQ
EKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGP
DYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKP
AVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAK
YNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCA
LMSCAKHKDYPFHAEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009985
NameBDBM50009985
Synonyms:CHEMBL69716 | [(4-Nitro-benzoyl)-phenyl-amino]-acetic acid
TypeSmall organic molecule
Emp. Form.C15H12N2O5
Mol. Mass.300.2662
SMILESOC(=O)CN(C(=O)c1ccc(cc1)[N+]([O-])=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a