Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose reductase (ALR2)
LigandBDBM50009777
Substrate/Competitorn/a
Meas. Tech.ChEMBL_31341
IC50 37.0±n/a nM
Citation Wrobel, JMillen, JSredy, JDietrich, AGorham, BJMalamas, MKelly, JMBauman, JGHarrison, MCJones, LR Syntheses of tolrestat analogues containing additional substituents in the ring and their evaluation as aldose reductase inhibitors. Identification of potent, orally active 2-fluoro derivatives. J Med Chem34:2504-20 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldose reductase (ALR2)
Name:Aldose reductase
Synonyms:Aldose reductase
Type:Protein
Mol. Mass.:35916.27
Organism:Bos taurus (Cattle)
Description:n/a
Residue:315
Sequence:
AHNIVLYTGAKMPILGLGTWKSPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLALQA
KLQEQVVKREDLFIVSKLWCTYHDKDLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKD
FFPLDEDGNVIPSEKDFVDTWTAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPA
VNQIECHPYLTQEKLIQYCNSKGIVVTAYSPLGSPDRPWAKPEDPSILEDPRIKAIADKY
NKTTAQVLIRFPIQRNLIVIPKSVTPERIAENFQVFDFELDKEDMNTLLSYNRDWRACAL
VSCASHRDYPFHEEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009777
NameBDBM50009777
Synonyms:(ponalrestat)[3-(4-Bromo-2-fluoro-benzyl)-4-oxo-3,4-dihydro-phthalazin-1-yl]-acetic acid | CHEMBL7679 | Ponalrestat | Ponalrestat (statil) | [3-(4-Bromo-2-fluoro-benzyl)-4-oxo-3,4-dihydro-phthalazin-1-yl]-acetic acid | [3-(4-Bromo-2-fluoro-benzyl)-4-oxo-3,4-dihydro-phthalazin-1-yl]-acetic acid(ponalrestat)
TypeSmall organic molecule
Emp. Form.C17H12BrFN2O3
Mol. Mass.391.191
SMILESOC(=O)Cc1nn(Cc2ccc(Br)cc2F)c(=O)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a