Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDelta-type opioid receptor
LigandBDBM50010540
Substrate/Competitorn/a
Meas. Tech.ChEBML_145634
IC50 4.6±n/a nM
Citation Yoshino, HNakazawa, TArakawa, YKaneko, TTsuchiya, YMatsunaga, MAraki, SIkeda, MYamatsu, KTachibana, S Synthesis and structure-activity relationships of dynorphin A-(1-8) amide analogues. J Med Chem33:206-12 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Delta-type opioid receptor
Name:Opioid receptor
Synonyms:DOR-1 | Delta-type opioid receptor | K56 | MSL-2 | OPIATE Delta | OPRD1
Type:Enzyme Catalytic Domain
Mol. Mass.:40577.25
Organism:MOUSE
Description:OPIATE Delta OPRD1 MOUSE::P32300
Residue:372
Sequence:
MELVPSARAELQSSPLVNLSDAFPSAFPSAGANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRTPCGRQEPGSLRRPRQATTRERVTAC
TPSDGPGGGAAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010540
NameBDBM50010540
Synonyms:2-[2-(2-{2-[3-(4-Hydroxy-phenyl)-2-methylamino-propionylamino]-acetylamino}-acetylamino)-3-phenyl-propionylamino]-4-methyl-pentanoic acid {1-[1-(1-ethylcarbamoyl-3-methyl-butylcarbamoyl)-4-guanidino-butylcarbamoyl]-4-guanidino-butyl}-amide | CHEMBL268105
TypeSmall organic molecule
Emp. Form.C49H79N15O9
Mol. Mass.1022.2467
SMILESCCNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](Cc1ccccc1)NC(=O)CNC(=O)CNC(=O)[C@H](Cc1ccc(O)cc1)NC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a