Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInosine Monophosphate Dehydrogenase Type 1 (IMPDH1)
LigandBDBM50010612
Substrate/Competitorn/a
Meas. Tech.ChEBML_89676
IC50 2500±n/a nM
Citation Nelson, PHEugui, EWang, CCAllison, AC Synthesis and immunosuppressive activity of some side-chain variants of mycophenolic acid. J Med Chem33:833-8 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Inosine Monophosphate Dehydrogenase Type 1 (IMPDH1)
Name:Inosine-5'-monophosphate dehydrogenase (IMPDH)
Synonyms:IMP dehydrogenase 1 | IMPD 1 | IMPDH-I | Inosine-5''-monophosphate dehydrogenase 1
Type:Enzyme
Mol. Mass.:55407.70
Organism:Homo sapiens (Human)
Description:Recombinant IMPDH1 expressed in E. coli.
Residue:514
Sequence:
MADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKIT
LKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVV
LSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMT
PRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDS
QKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVI
GGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVP
IIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAM
EKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLR
SMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010612
NameBDBM50010612
Synonyms:7-(4-Hydroxy-6-methoxy-7-methyl-3-oxo-1,3-dihydro-isobenzofuran-5-yl)-hept-5-ynoic acid | CHEMBL169309
TypeSmall organic molecule
Emp. Form.C17H18O6
Mol. Mass.318.3212
SMILESCOc1c(C)c2COC(=O)c2c(O)c1CC#CCCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a