Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBCoR-BCL6
LigandBDBM50266779
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1701331
Kd 9300±n/a nM
Citation Kamada, YSakai, NSogabe, SIda, KOki, HSakamoto, KLane, WSnell, GIida, MImaeda, YSakamoto, JMatsui, J Discovery of a B-Cell Lymphoma 6 Protein-Protein Interaction Inhibitor by a Biophysics-Driven Fragment-Based Approach. J Med Chem60:4358-4368 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
BCoR-BCL6
Name:BCoR-BCL6
Synonyms:B-cell lymphoma 5 protein | B-cell lymphoma 6 protein | BCL-5 | BCL-6 | BCL5 | BCL6 | LAZ3 | Protein LAZ-3 | ZBTB27 | ZNF51 | Zinc finger and BTB domain-containing protein 27 | Zinc finger protein 51
Type:PROTEIN
Mol. Mass.:78866.89
Organism:Homo sapiens
Description:ChEMBL_117695
Residue:706
Sequence:
MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSI
FTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDT
CRKFIKASEAEMVSAIKPPREEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAF
APSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFPKERALPCDSARPVPG
EYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKAS
KEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASG
SPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEP
ENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGS
QSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQT
HSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEK
PYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHC
EKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPPELPKAC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50266779
NameBDBM50266779
Synonyms:CHEMBL4090952
TypeSmall organic molecule
Emp. Form.C12H9ClN4O
Mol. Mass.260.679
SMILESClc1cncnc1Nc1ccc2NC(=O)Cc2c1
Structure
n/a