Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50011853
Substrate/Competitorn/a
Meas. Tech.ChEBML_154999
IC50 30±n/a nM
Citation Walser, AFlynn, TMason, CCrowley, HMaresca, CO'Donnell, M Thienotriazolodiazepines as platelet-activating factor antagonists. Steric limitations for the substituent in position 2. J Med Chem34:1440-6 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF Platelet activating factor | PAF-R | Platelet-activating factor receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:39219.60
Organism:Homo sapiens (Human)
Description:PAF Platelet activating factor PTAFR HUMAN::P25105
Residue:342
Sequence:
MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50011853
NameBDBM50011853
Synonyms:4-(2-Chloro-phenyl)-2-[2-(4-isobutyl-phenyl)-ethyl]-9-methyl-6H-1-thia-5,7,8,9a-tetraaza-cyclopenta[e]azulene | CHEMBL32942
TypeSmall organic molecule
Emp. Form.C27H27ClN4S
Mol. Mass.475.048
SMILESCC(C)Cc1ccc(CCc2cc3c(s2)-n2c(C)nnc2CN=C3c2ccccc2Cl)cc1 |c:24|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a