Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetArachidonate 12-lipoxygenase
LigandBDBM50011933
Substrate/Competitorn/a
Meas. Tech.ChEBML_218
IC50 470±n/a nM
Citation Cho, HUeda, MTamaoka, MHamaguchi, MAisaka, KKiso, YInoue, TOgino, RTatsuoka, TIshihara, T Novel caffeic acid derivatives: extremely potent inhibitors of 12-lipoxygenase. J Med Chem34:1503-5 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Arachidonate 12-lipoxygenase
Name:Arachidonate 12-lipoxygenase
Synonyms:12-LOX | 12/15-lipoxygenase | 15-LOX | Alox12l | Alox15 | Arachidonate 12-lipoxygenase, leukocyte-type | Arachidonate omega-6 lipoxygenase
Type:PROTEIN
Mol. Mass.:75377.59
Organism:Rattus norvegicus
Description:ChEMBL_1510006
Residue:663
Sequence:
MGVYRIRVSTGDSKYAGSNNEVYLWLVGQHGEASLGKLLRPCRDSEAEFKVDVSEYLGPL
LFVRVQKWHYLTDDAWFCNWISVKGPGDQGSEYMFPCYRWVQGRSILSLPEGTGCTVVED
SQGLFRKHREEELEERRSLYRWGNWKDGSILNVAAASISDLPVDQRFREDKRIEFEASQV
IGVMDTVVNFPINTVTCWKSLDDFNCVFKSGHTKMAERVRNSWKEDAFFGYQFLNGANPM
VLKRSTCLPARLVFPPGMEKLQAQLNKELQKGTLFEADFFLLDGIKANVILCSQQYLAAP
LVMLKLMPDGQLLPIAIQLELPKTGSTPPPIFTPSDPPMDWLLAKCWVRSSDLQLHELQA
HLLRGHLMAEVFAVATMRCLPSVHPVFKLLVPHLLYTMEINVRARSDLISERGFFDKAMS
TGGGGHLDLLKQAGAFLTYCSLCPPDDLAERGLLDIETCFYAKDALRLWQIMNRYVVGMF
NLHYKTDKAVQDDYELQSWCREITDIGLQGAQDRGFPTSLQSRAQACYFITMCIFTCTAQ
HSSVHLGQLDWFYWVPNAPCTMRLPPPTTKEATMEKLMATLPNPNQSTLQINVVWLLGRR
QAVMVPLGQHSEEHFPNPEAKAVLKKFREELAALDKEIEIRNKSLDIPYEYLRPSMVENS
VAI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50011933
NameBDBM50011933
Synonyms:2-Cyano-3-(3,4-dihydroxy-phenyl)-acrylic acid 4-phenyl-butyl ester | CHEMBL417327
TypeSmall organic molecule
Emp. Form.C20H19NO4
Mol. Mass.337.3692
SMILESOc1ccc(\C=C(/C#N)C(=O)OCCCCc2ccccc2)cc1O
Structure
n/a