Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCysteinyl leukotriene receptor 1/2
LigandBDBM50009075
Substrate/Competitorn/a
Meas. Tech.ChEMBL_52221
Ki 0.200000±n/a nM
Citation Galemmo, RAJohnson, WHLearn, KSLee, TDHuang, FCCampbell, HFYoussefyeh, RO'Rourke, SVSchuessler, GSweeney, DM The development of a novel series of (quinolin-2-ylmethoxy)phenyl-containing compounds as high-affinity leukotriene receptor antagonists. 3. Structural variation of the acidic side chain to give antagonists of enhanced potency. J Med Chem33:2828-41 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cysteinyl leukotriene receptor 1/2
Name:Cysteinyl leukotriene receptor 1/2
Synonyms:Cysteinyl leukotriene receptor
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 98640
Components:This complex has 2 components.
Component 1
Name:Cysteinyl leukotriene receptor 1
Synonyms:CYSLTR1 | Cysteinyl leukotriene D4 receptor | Cysteinyl leukotriene receptor | Cysteinyl leukotriene receptor 1 | HG55 | HMTMF81 | LTD4 receptor | Leukotriene Cysteinyl 1
Type:Enzyme Catalytic Domain
Mol. Mass.:38565.16
Organism:Homo sapiens (Human)
Description:Leukotriene Cysteinyl 1 CYSLTR1 HUMAN::Q9Y271
Residue:337
Sequence:
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQV
YMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFF
RCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDN
QTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTA
AFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGG
NFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Cysteinyl leukotriene receptor 2
Synonyms:CYSLTR2 | Cysteinyl leukotriene receptor | Cysteinyl leukotriene receptor 2 | Leukotriene Cysteinyl 2
Type:Enzyme Catalytic Domain
Mol. Mass.:39657.52
Organism:Homo sapiens (Human)
Description:Leukotriene Cysteinyl 2 CYSLTR2 HUMAN::Q9NS75
Residue:346
Sequence:
MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSI
YVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYV
NMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQ
NGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRV
SHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACF
NPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009075
NameBDBM50009075
Synonyms:CHEMBL22033 | ICI 198615 | ICI-198615 | [1-(4-Benzenesulfonylaminocarbonyl-2-methoxy-benzyl)-1H-indazol-5-yl]-carbamic acid cyclopentyl ester | [1-(4-Benzenesulfonylaminocarbonyl-2-methoxy-benzyl)-1H-indazol-6-yl]-carbamic acid cyclopentyl ester | [1-(4-Benzenesulfonylaminocarbonyl-2-methoxy-benzyl)-1H-indazol-6-yl]-carbamic acid cyclopentyl ester (ICI 198,615) | [1-(4-Benzenesulfonylaminocarbonyl-2-methoxy-benzyl)-1H-indazol-6-yl]-carbamic acid cyclopentyl ester(ICI 198, 615) | [1-(4-Benzenesulfonylaminocarbonyl-2-methoxy-benzyl)-1H-indazol-6-yl]-carbamic acid cyclopentyl ester(ICI 198615)
TypeSmall organic molecule
Emp. Form.C28H28N4O6S
Mol. Mass.548.61
SMILESCOc1cc(ccc1Cn1ncc2ccc(NC(=O)OC3CCCC3)cc12)C(=O)NS(=O)(=O)c1ccccc1
Structure
n/a