Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThymidylate synthase
LigandBDBM50014706
Substrate/Competitorn/a
Meas. Tech.ChEBML_209294
IC50>100000±n/a nM
Citation DeGraw, JIChristie, PHKisliuk, RLGaumont, YSirotnak, FM Synthesis and antifolate properties of 9-alkyl-10-deazaminopterins. J Med Chem33:212-5 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thymidylate synthase
Name:Thymidylate synthase
Synonyms:TSase | Thymidylate Synthase (TS) | Thymidylate synthase
Type:Enzyme
Mol. Mass.:36576.54
Organism:Lactobacillus casei
Description:n/a
Residue:316
Sequence:
MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSKGFPLLTTKKVPFGLIKSE
LLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHE
EMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTSKGDTIDQLGDVIEQIKTHPYSRRL
IVSAWNPEDVPTMALPPCHTLYQFYVNDGKLSLQLYQRSADIFLGVPFNIASYALLTHLV
AHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDFDMKDIK
LLNYDPYPAIKAPVAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50014706
NameBDBM50014706
Synonyms:2-{4-[2-(2,4-Diamino-pteridin-6-yl)-butyl]-benzoylamino}-pentanedioic acid | CHEMBL302068
TypeSmall organic molecule
Emp. Form.C22H25N7O5
Mol. Mass.467.4778
SMILESCCC(Cc1ccc(cc1)C(=O)NC(CCC(O)=O)C(O)=O)c1cnc2nc(N)nc(N)c2n1
Structure
n/a