Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose reductase
LigandBDBM50016613
Substrate/Competitorn/a
Meas. Tech.ChEMBL_32068
IC50 220000±n/a nM
Citation DeRuiter, JSwearingen, BEWandrekar, VMayfield, CA Synthesis and in vitro aldose reductase inhibitory activity of compounds containing an N-acylglycine moiety. J Med Chem32:1033-8 (1989) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldose reductase
Name:Aldose reductase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:35797.87
Organism:Rattus norvegicus
Description:ChEMBL_1512484
Residue:316
Sequence:
MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQ
EKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGP
DYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKP
AVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAK
YNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCA
LMSCAKHKDYPFHAEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50016613
NameBDBM50016613
Synonyms:(4-Methyl-benzoylamino)-acetic acid | 4-Methylhippuric acid | CHEMBL274877
TypeSmall organic molecule
Emp. Form.C10H11NO3
Mol. Mass.193.1992
SMILESCc1ccc(cc1)C(=O)NCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a