Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEgl nine homolog 1
LigandBDBM50318459
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1733858
IC50 1.9±n/a nM
Citation Joharapurkar, AAPandya, VBPatel, VJDesai, RCJain, MR Prolyl Hydroxylase Inhibitors: A Breakthrough in the Therapy of Anemia Associated with Chronic Diseases. J Med Chem61:6964-6982 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Egl nine homolog 1
Name:Egl nine homolog 1
Synonyms:Egl nine homolog 1 (EGLN1) | Hypoxia-inducible factor prolyl hydroxylase 2 (HIF-PH2) | Hypoxia-inducible factor prolyl hydroxylase 2 (HIFPH2) | Prolyl hydroxylase domain-containing protein 2 (PHD2)
Type:Protein
Mol. Mass.:46035.59
Organism:Homo sapiens (Human)
Description:Q9GZT9
Residue:426
Sequence:
MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQG
SEGALGHGVGPHQHSGPAPPAAVPPPRAGAREPRKAAARRDNASGDAAKGKVKAKPPADP
AAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLR
PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQL
VSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMV
ACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKF
DRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDS
VGKDVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50318459
NameBDBM50318459
Synonyms:CHEMBL4159227
TypeSmall organic molecule
Emp. Form.C23H16F3N3O5
Mol. Mass.471.3854
SMILESOC(=O)CNC(=O)c1c(O)c2cc(cc3CC(Cn(c23)c1=O)c1ccc(cc1)C(F)(F)F)C#N
Structure
n/a